PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A03G0594
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 344aa    MW: 37588.8 Da    PI: 4.8354
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A03G0594genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.53.5e-091445132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     +g+WT+eEd++l+ +++++G g W+  +++ g
      Gh_A03G0594 14 KGAWTAEEDQKLISYIQKHGEGGWRFLPQKAG 45
                     79***********************9999988 PP

2Myb_DNA-binding53.74.8e-1794138147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T+eEd+ ++++ ++lG++ W++Iar++  +Rt++++k++w+ +
      Gh_A03G0594  94 RGDFTPEEDKTIIKLQAELGNR-WAAIARHLS-NRTDNEIKNYWNAH 138
                      899*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500909.907988IPR017877Myb-like domain
SuperFamilySSF466891.65E-7944IPR009057Homeodomain-like
SMARTSM007174.2E-71390IPR001005SANT/Myb domain
PfamPF002491.9E-71445IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-221595IPR009057Homeodomain-like
CDDcd001677.31E-71688No hitNo description
SuperFamilySSF466891.8E-2274145IPR009057Homeodomain-like
PROSITE profilePS5129425.49889143IPR017930Myb domain
SMARTSM007174.2E-1793141IPR001005SANT/Myb domain
PfamPF002491.6E-1594139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2596143IPR009057Homeodomain-like
CDDcd001671.13E-1297139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGRTPFCSSD GLKKGAWTAE EDQKLISYIQ KHGEGGWRFL PQKAGNSLGF LPIWALFYFL  60
LLCPCSNFGF AGLQRCGKSC RLRWANYLRP GIKRGDFTPE EDKTIIKLQA ELGNRWAAIA  120
RHLSNRTDNE IKNYWNAHLK KRLANMGADQ VTVSGASSSS GNSDSNAVTN TECAKPQQSE  180
PTKKRSASAL LLNKLATRVT QCVGPLRASQ TLQQPTMPFN GGAENSDIFC HPLPSSTPES  240
TSWADNNNSS NSLTIPECGT TNAIDERDSS SSAGVLNDIV ASEFASPTCV DELSDWVNTN  300
YSIEPEQVQI DYSDSMTVGY GGLWDDDVIV VDDDDYTVGS LGFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C5e-24121432105C-Myb DNA-Binding Domain
1mse_C5e-24121432105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012470775.10.0PREDICTED: transcription factor MYB34
SwissprotO643992e-59MYB34_ARATH; Transcription factor MYB34
TrEMBLA0A0D2MLR50.0A0A0D2MLR5_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60890.12e-59myb domain protein 34